PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 456aa    MW: 48322.8 Da    PI: 7.2824
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038022genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
      Lus10038022 14 KGLWSPEEDEKLLRHITKFGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.73e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      Lus10038022  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.337961IPR017930Myb domain
SuperFamilySSF466895.62E-2912108IPR009057Homeodomain-like
SMARTSM007179.4E-131363IPR001005SANT/Myb domain
PfamPF002497.9E-151461IPR001005SANT/Myb domain
CDDcd001673.48E-111761No hitNo description
PROSITE profilePS5129425.26162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565116IPR009057Homeodomain-like
SMARTSM007179.8E-1366114IPR001005SANT/Myb domain
PfamPF002493.3E-1367111IPR001005SANT/Myb domain
CDDcd001679.77E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KFGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVDIENKNIN NSSSSPGGAE GGGGGEENFV SSELNLLKQE KSNNMKALSS  180
VGGGGGLMGG GDVDKDFLLE RFAAVGSCHQ SPPPTDLVGH LNFPLHQLNY SAATSVADGR  240
LSTNSIPSLW YSGGGGGGGG KPFDMNSDFS SPTAAISIPS SFPYKPASVG GGGGGDNSXX  300
XXXXXXXXXX XXXXXXXXXX XSGAAAAGGG PPSSNNSSSG SSSSFFDTAA IFSWGIGDCG  360
TSEKGMGPAG AGATASAAQD DIKWPEYMNN PLLMSANQTQ LYSNNNDIKS ESHFLPESSS  420
SVWIHGGGDG GQQQFSDLSC PKDFQRLSAA YGHIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
1h8a_C4e-291111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572455.11e-145PREDICTED: transcription factor MYB86
TrEMBLB9I9971e-140B9I997_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10680.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-90myb domain protein 55